That's a graphic image from the Blek Sheep website. Read more www.raevskaya-repnina.com.

WHITE AND FLUFFY

BLENDED IN WITH THE CROWD?

 
#bleksheep is a digital marketing company working abroad.  We develop creative content and support communication on social media and on the internet based on sensitive marketing concepts. #bleksheep #painlesdigitalcraft #digitalmarketing #brandidentityagency #branddesign #digitalcommunication #socialmedia #webpresence #digitalface #plugandplaybusiness #boostbusinesstuning #turndownthenoice #noneedtoscream #sensitivemarketing #bleksheep #painlesdigitalcraft #digitalmarketing #brandidentityagency #branddesign #digitalcommunication #socialmedia #webpresence #digitalface #plugandplaybusiness #boostbusinesstuning #turndownthenoice #noneedtoscream #sensitivemarketing #hasheight #boost #raevskayarepninaannamariaserafima #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина #raevskayarepninaannamariaserafima #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима

#bleksheep is a digital communication company working abroad. We develop creative content and support communication on social media and the internet based on sensitive marketing concepts.

#bleksheep is a digital marketing company working abroad.  We develop creative content and support communication on social media and on the internet based on sensitive marketing concepts. #bleksheep #painlesdigitalcraft #digitalmarketing #brandidentityagency #branddesign #digitalcommunication #socialmedia #webpresence #digitalface #plugandplaybusiness #boostbusinesstuning #turndownthenoice #noneedtoscream #sensitivemarketing #bleksheep #painlesdigitalcraft #digitalmarketing #brandidentityagency #branddesign #digitalcommunication #socialmedia #webpresence #digitalface #plugandplaybusiness #boostbusinesstuning #turndownthenoice #noneedtoscream #sensitivemarketing #hasheight #boost #raevskayarepninaannamariaserafima #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина #raevskayarepninaannamariaserafima #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #раевскаярепнина #oxfordbusinessalumni #startedinoxford #saidbusinessschool #oxfordsbs #oxford #moscow #london #russia #uk #womanfounders #serialentrepreneur #womeninlaw #womeninbusiness #theuniversityofoxford #innovateuk

TURN DOWN THE NOISE

If the customers' heart does not want to buy your products, nothing will come of it.

It is impossible to stand out in color or sound among the incredible aggressive advertising noise everywhere. Louder, brighter, more intensity? Customers don't want to observe painful aggressive, noisy commercials anymore. They are destructively exploiting the frontal cortex of the human brain, and the attempts to be distinguished among others with the same intentions led to the opposite effect of convergency. That means that the wide distribution of hard-selling advertising eliminates identity but, in contradiction, increases brand blending among the companies. It took a practiced eye to spot the difference because there is any. A useless cash-burning is not the only consequence of the attempt to shout down of crowd. Such type of marketing damages health of people by stimulating hyperactivity of the brain and affecting neuroscience processes. What is to do? There are two ways to be noticed in the crowd: to scream louder than others or stay silent. Blek Sheep offers the third way to communicate with meta-messages detecting by heart and awakening other brain segments.

#bleksheep is a digital marketing company working abroad.  We develop creative content and support communication on social media and on the internet based on sensitive marketing concepts. #bleksheep #painlesdigitalcraft #digitalmarketing #brandidentityagency #branddesign #digitalcommunication #socialmedia #webpresence #digitalface #plugandplaybusiness #boostbusinesstuning #turndownthenoice #noneedtoscream #sensitivemarketing #bleksheep #painlesdigitalcraft #digitalmarketing #brandidentityagency #branddesign #digitalcommunication #socialmedia #webpresence #digitalface #plugandplaybusiness #boostbusinesstuning #turndownthenoice #noneedtoscream #sensitivemarketing #hasheight #boost #raevskayarepninaannamariaserafima #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина #raevskayarepninaannamariaserafima #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #раевскаярепнина #oxfordbusinessalumni #startedinoxford #saidbusinessschool #oxfordsbs #oxford #moscow #london #russia #uk #womanfounders #serialentrepreneur #womeninlaw #womeninbusiness #theuniversityofoxford #innovateuk

NO NEED TO SCREAM

 
Time to become black to be spotted. 

The Blek Sheep stays apart from the crowd not due to the different color but by meaning. We use sensitive marketing that doesn't aggressively exploit the human senses. That doesn't create a harmful aggressive effect on people to induce them to buy. We are targeting customers' soul, heart, and brain curiosity to stimulate another type of cognitive activity - research, discovery, investigation, analysis, synthesis. That evokes a sincere willingness to discover the product, learn more, and buy.

Our concept has the fundamental ground base of being distinguished not by the increasing level of noise but by the meaning of the meta-message that we bring to customers. Therefore, we do not affect our customers by bright colors, aggressive slogans, and standard sales promoting phrases. We are setting up the harmless meta-communication through using the full range of depth of symbolism and visual patterns with multiple meanings, which are not used for "normal" ordinary advertising. We awake the curiosity of an inner child, the exuberance of getting new knowledge, the willingness to discover more and to continue further communication with the brand. 

OUR SERVICES

BRAND IDENTITY

Blek Sheep specializes in creating unique elements of identity to boost your brand that will help set you apart from the crowd and have a high impact to generate the results targeted to succeed in your business without affecting health of people.

STORYTELLING

We believe you must bring your whole self to the table if you want to thrive in today’s crazy world to engage your audience. We offer storytelling services in such heavy, complicated areas as business, science, investments, economics. We prepare media content, presentations, reports, pitches and help you to support meaningful communication in social media. 

DIGITAL DESIGN

Blek Sheep is a firm making a painless digital craft that is based on the principles of sensitive marketing. We are committed to help businesses grow and succeed through design that brings pleasant emotions, not pain, to your customers, leads to customer awareness, and conscious customer choice. Get in touch to find out about our specific services.

DIGITAL FACE

We provide a package deal - brand identity elements, organization of web presence, and support communication in digital media. Our offer includes elements of brand identity necessary for digital communication, we set up of digital ground base consisting of the website, profiles on social media, development of the initial content to post there.

COMMUNICATIONS

Blek Sheep offers a wide range of services, including media relations, branding and strategy, press conferences, and more. We work with you to customize messaging that best represents your business and maintain communication in social media. See what we offer below, and feel free to get in touch with any questions.

 
#bleksheep is a digital marketing company working abroad.  We develop creative content and support communication on social media and on the internet based on sensitive marketing concepts. #bleksheep #painlesdigitalcraft #digitalmarketing #brandidentityagency #branddesign #digitalcommunication #socialmedia #webpresence #digitalface #plugandplaybusiness #boostbusinesstuning #turndownthenoice #noneedtoscream #sensitivemarketing #bleksheep #painlesdigitalcraft #digitalmarketing #brandidentityagency #branddesign #digitalcommunication #socialmedia #webpresence #digitalface #plugandplaybusiness #boostbusinesstuning #turndownthenoice #noneedtoscream #sensitivemarketing #hasheight #boost #raevskayarepninaannamariaserafima #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина #raevskayarepninaannamariaserafima #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #раевскаярепнина #oxfordbusinessalumni #startedinoxford #saidbusinessschool #oxfordsbs #oxford #moscow #london #russia #uk #womanfounders #serialentrepreneur #womeninlaw #womeninbusiness #theuniversityofoxford #innovateuk
Plug & Play Business

BOOST BUSINESS TUNING

When you start your own business, you need many more elements than just an incorporated legal entity to succeed. To begin, you shall have a digital face, a brand name & logo, the same-name legal entity, the same-name domain name, an accountant, a lawyer, a bank account, stamps, website, social media profiles, phone, office, or legal address, business cards, and the templates of documents. BOOST offers plug & play business service when you get the business ready for operations - you have the logo & brand book, documentation templates, legal entity, bank account, accountant, phone, digital face, and legally compliant office. Your business will be ready in 2 weeks. You will get the legal entity with the all necessary attributes to communicate with clients, vendors, employees, the public sector, and ready-for-operation business infrastructure for the startup. As soon as you have plug & play business, you can use the BOOST'shared services and #8 plug and play business tracker. As a part of the plug & play business, Blek Sheep exclusively provides digital design, branding, maintenance of digital communication, and organization of web presence for your business.

#bleksheep is a digital marketing company working abroad.  We develop creative content and support communication on social media and on the internet based on sensitive marketing concepts. #bleksheep #painlesdigitalcraft #digitalmarketing #brandidentityagency #branddesign #digitalcommunication #socialmedia #webpresence #digitalface #plugandplaybusiness #boostbusinesstuning #turndownthenoice #noneedtoscream #sensitivemarketing #bleksheep #painlesdigitalcraft #digitalmarketing #brandidentityagency #branddesign #digitalcommunication #socialmedia #webpresence #digitalface #plugandplaybusiness #boostbusinesstuning #turndownthenoice #noneedtoscream #sensitivemarketing #hasheight #boost #raevskayarepninaannamariaserafima #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина #raevskayarepninaannamariaserafima #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #раевскаярепнина #oxfordbusinessalumni #startedinoxford #saidbusinessschool #oxfordsbs #oxford #moscow #london #russia #uk #womanfounders #serialentrepreneur #womeninlaw #womeninbusiness #theuniversityofoxford #innovateuk
 

DID YOU SAY "ADVERTISING"?

That's a graphic image from the Blek Sheep website. Read more www.raevskaya-repnina.com.

No, Joe Six-pack.
We don't do this crap.

#bleksheep is a digital marketing company working abroad.  We develop creative content and support communication on social media and on the internet based on sensitive marketing concepts. #bleksheep #painlesdigitalcraft #digitalmarketing #brandidentityagency #branddesign #digitalcommunication #socialmedia #webpresence #digitalface #plugandplaybusiness #boostbusinesstuning #turndownthenoice #noneedtoscream #sensitivemarketing #bleksheep #painlesdigitalcraft #digitalmarketing #brandidentityagency #branddesign #digitalcommunication #socialmedia #webpresence #digitalface #plugandplaybusiness #boostbusinesstuning #turndownthenoice #noneedtoscream #sensitivemarketing #hasheight #boost #raevskayarepninaannamariaserafima #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина #raevskayarepninaannamariaserafima #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #раевскаярепнина #oxfordbusinessalumni #startedinoxford #saidbusinessschool #oxfordsbs #oxford #moscow #london #russia #uk #womanfounders #serialentrepreneur #womeninlaw #womeninbusiness #theuniversityofoxford #innovateuk

DON'T ADVERTISE. EVANGELIZE.

10 commandments
of sensitive marketing 
  1. Know your customer. All products are bought by the soul. Don't scream about your products, and don't punch your customers' brains with Timberlands. You will get the opposite effect of hate, neglect, and abruption.

  2. Know who is a guide. A human is guided in his choice by his heart. The heart operates different senses comparing to human eyes, ears, nose, and skin.

  3. Know buying reason. Products appealing to the soul and heart don't need advertising. Have you ever seen the advertising for church candles? Maybe, you've participated in the Black Friday to get more Holy Bible books in the Monastery bookstore? Or you came to the Church because somebody gave you a promo coupon with a 50% discount for the Eucharist? When you understand why did you come to Church/Mosque/Synagogue/another place for common praying, and introduce this consumer model into your business, you will sell your products without any advertising.

  4. Know who you are. Do not advertise. Digitalize. Make your digital face that is remembered, digitalize the presence of your company and your products. When you get your passport, you don't scream about that every day 24/7.

  5. Know the pain. Do not advertise. Evangelize. Your product shall create meaning for people and treat the pain that exists. Don't be trapped by the dogma that the startup founders "know the pain". They "brainstorm" the pains. They excogitate the pains to persuade investors to give them money. They know nothing about their customers and don't want to know that. They need money to cover the living costs, and if they fail - no problem, it was a risky startup and blablabla. Treat the pain you have and do the product for yourself. At least, you will have one customer for your product.

  6. Create great products. Only great products have a chance to be evangelized. A piece of crap can't be successful even advertised, no talking about evangelization.

  7. Be perfect. The simplest way to create a great product is to become a perfectionist and do the product for yourself that you would by your soul and heart.

  8. Make people happy. Does your product make people happy? Ask yourself, does that make you happy if you buy that? If no - continue to work on the product, not on advertising.

  9. Do not make people unhappy. Do not bully their brains and organs of senses by hard-selling advertising, spam, and "cold calls." In terms of digital marketing, all you need are a digital signboard, digital reception, and digital cashdesk.

  10. Feed souls. Make products dedicated to the soul, not to the body.

Green Pastures
 

PORTFOLIO

To play, press and hold the enter key. To stop, release the enter key.

 

GET THE QUOTE

Thanks for submitting! We handle all incoming requests within 48 hours.

 
 
#bleksheep is a digital marketing company working abroad.  We develop creative content and support communication on social media and on the internet based on sensitive marketing concepts. #bleksheep #painlesdigitalcraft #digitalmarketing #brandidentityagency #branddesign #digitalcommunication #socialmedia #webpresence #digitalface #plugandplaybusiness #boostbusinesstuning #turndownthenoice #noneedtoscream #sensitivemarketing #bleksheep #painlesdigitalcraft #digitalmarketing #brandidentityagency #branddesign #digitalcommunication #socialmedia #webpresence #digitalface #plugandplaybusiness #boostbusinesstuning #turndownthenoice #noneedtoscream #sensitivemarketing #hasheight #boost #raevskayarepninaannamariaserafima #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина #raevskayarepninaannamariaserafima #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #раевскаярепнина #oxfordbusinessalumni #startedinoxford #saidbusinessschool #oxfordsbs #oxford #moscow #london #russia #uk #womanfounders #serialentrepreneur #womeninlaw #womeninbusiness #theuniversityofoxford #innovateuk

PAINLES DIGITAL CRAFT